Mouse Anti-Arabidopsis CHLG Antibody (CBMOAB-26012FYC)


Cat: CBMOAB-26012FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO26012FC
SpecificityThis antibody binds to Arabidopsis CHLG.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Chloroplast; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInvolved in one of the last steps of the biosynthesis of chlorophyll a. Catalyzes the esterification of chlorophillide a or b with a preference for geranylgeranyldiphosphate (GGPP) rather than for phytyldiphosphate (PhyPP).
Product OverviewMouse Anti-Arabidopsis CHLG (clone MO26012FC) Antibody (CBMOAB-26012FYC) is a mouse antibody against CHLG. It can be used for CHLG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChlorophyll synthase, chloroplastic; EC 2.5.1.62; Polyprenyl transferase; Protein G4; AtG4; CHLG; G4; At3g51820
UniProt IDQ38833
Protein RefseqThe length of the protein is 387 amino acids long. The sequence is show below: MTSILNTVSTIHSSRVTSVDRVGVLSLRNSDSVEFTRRRSGFSTLIYESPGRRFVVRAAETDTDKVKSQTPDKAPAGGSSINQLLGIKGASQETNKWKIRLQLTKPVTWPPLVWGVVCGAAASGNFHWTPEDVAKSILCMMMSGPCLTGYTQTINDWYDRDIDAINEPYRPIPSGAISEPEVITQVWVLLLGGLGIAGILDVWAGHTTPTVFYLALGGSLLSYIYSAPPLKLKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEGDRALGLQSLPVAFGTETAKWICVGAIDITQLSVAGYLLASGKPYYALALVALIIPQIVFQFKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASQH.
For Research Use Only | Not For Clinical Use.

Online Inquiry