Mouse Anti-D2HGDH Antibody (CBMOAB-27341FYC)
Cat: CBMOAB-27341FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-27341FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) | WB, ELISA | MO27341FC | 100 µg | ||
CBMOAB-40357FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO40357FYA | 100 µg | ||
CBMOAB-72836FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO72836FYA | 100 µg | ||
CBMOAB-22470FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO22470FYB | 100 µg | ||
MO-AB-20099W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20099W | 100 µg | ||
MO-AB-53876W | Monoclonal | Marmoset | WB, ELISA | MO53876W | 100 µg | ||
MO-AB-11161R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11161R | 100 µg | ||
MO-DKB-00206W | Polyclonal | Zebrafish (Danio rerio) | ELISA | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) |
Clone | MO27341FC |
Specificity | This antibody binds to Arabidopsis D2HGDH. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Plasma Membrane |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes D-2hydroxyglutarate dehydrogenase, a mitochondrial enzyme belonging to the FAD-binding oxidoreductase/transferase type 4 family. This enzyme, which is most active in liver and kidney but also active in heart and brain, converts D-2-hydroxyglutarate to 2-ketoglutarate. Mutations in this gene are present in D-2-hydroxyglutaric aciduria, a rare recessive neurometabolic disorder causing developmental delay, epilepsy, hypotonia, and dysmorphic features. D2HGDH (D-2-Hydroxyglutarate Dehydrogenase) is a Protein Coding gene. Diseases associated with D2HGDH include D-2-Hydroxyglutaric Aciduria 1 and 2-Hydroxyglutaric Aciduria. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Pyruvate metabolism and Citric Acid (TCA) cycle. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and oxidoreductase activity, acting on CH-OH group of donors. Catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate. (From NCBI) |
Product Overview | Mouse Anti-Arabidopsis D2HGDH Antibody is a mouse antibody against D2HGDH. It can be used for D2HGDH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | D-2-Hydroxyglutarate Dehydrogenase; D2HGD; D-2-Hydroxyglutarate Dehydrogenase, Mitochondrial; EC 1.1.99.-; EC 1.1.99 |
UniProt ID | O23240 |
Protein Refseq | The length of the protein is 559 amino acids long. The sequence is show below: MMMQKLRRSGEFIRFGCKSLISSRPNKDSVSRSVSGFVNHYKSKGKLFELSDGNYKTELHHPCISRNVGMLLQQYKCFGSSAASLIQRNPLFSSLDSKDVSYFKEILGEKNVVEDKERLETANTDWMHKYKGSSKLMLLPKNTQEVSQILEYCDSRRLAVVPQGGNTGLVGGSVPVFDEVIVNVGLMNKILSFDEVSGVLVCEAGCILENLATFLDTKGFIMPLDLGAKGSCHIGGNVSTNAGGLRLIRYGSLHGTVLGLEAVTANGNVLDMLGTLRKDNTGYDLKHLFIGSEGSLGIVTKVSILTQPKLSSVNLAFIACKDYLSCQKLLVEAKRNLGEILSAFEFLDNNSMDLVLNHLDGVRNPVSSSENFYILIETTGSDETNDREKLEAFLLKSLEKGLVSDGVIAQDINQASSFWRIREGITEALQKAGAVYKYDLSLPVEEIYNIVNDLRGRLGDLANVMGYGHLGDGNLHLNISAAEYNDKLLGLIEPYVYEWTSKHRGSISAEHGLGVMKANEIFYSKSPETVALMASIKKLLDPKGILNPYKVLPHSLFSN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry