Mouse Anti-D2HGDH Antibody (CBMOAB-27341FYC)


Cat: CBMOAB-27341FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-27341FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) WB, ELISA MO27341FC 100 µg
CBMOAB-40357FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO40357FYA 100 µg
CBMOAB-72836FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72836FYA 100 µg
CBMOAB-22470FYB Monoclonal Rice (Oryza) WB, ELISA MO22470FYB 100 µg
MO-AB-20099W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20099W 100 µg
MO-AB-53876W Monoclonal Marmoset WB, ELISA MO53876W 100 µg
MO-AB-11161R Monoclonal Cattle (Bos taurus) WB, ELISA MO11161R 100 µg
MO-DKB-00206W Polyclonal Zebrafish (Danio rerio) ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio)
CloneMO27341FC
SpecificityThis antibody binds to Arabidopsis D2HGDH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Plasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes D-2hydroxyglutarate dehydrogenase, a mitochondrial enzyme belonging to the FAD-binding oxidoreductase/transferase type 4 family. This enzyme, which is most active in liver and kidney but also active in heart and brain, converts D-2-hydroxyglutarate to 2-ketoglutarate. Mutations in this gene are present in D-2-hydroxyglutaric aciduria, a rare recessive neurometabolic disorder causing developmental delay, epilepsy, hypotonia, and dysmorphic features. D2HGDH (D-2-Hydroxyglutarate Dehydrogenase) is a Protein Coding gene. Diseases associated with D2HGDH include D-2-Hydroxyglutaric Aciduria 1 and 2-Hydroxyglutaric Aciduria. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Pyruvate metabolism and Citric Acid (TCA) cycle. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and oxidoreductase activity, acting on CH-OH group of donors. Catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate.
Product OverviewMouse Anti-Arabidopsis D2HGDH Antibody is a mouse antibody against D2HGDH. It can be used for D2HGDH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesD-2-Hydroxyglutarate Dehydrogenase; D2HGD; D-2-Hydroxyglutarate Dehydrogenase, Mitochondrial; EC 1.1.99.-; EC 1.1.99
UniProt IDO23240
Protein RefseqThe length of the protein is 559 amino acids long. The sequence is show below: MMMQKLRRSGEFIRFGCKSLISSRPNKDSVSRSVSGFVNHYKSKGKLFELSDGNYKTELHHPCISRNVGMLLQQYKCFGSSAASLIQRNPLFSSLDSKDVSYFKEILGEKNVVEDKERLETANTDWMHKYKGSSKLMLLPKNTQEVSQILEYCDSRRLAVVPQGGNTGLVGGSVPVFDEVIVNVGLMNKILSFDEVSGVLVCEAGCILENLATFLDTKGFIMPLDLGAKGSCHIGGNVSTNAGGLRLIRYGSLHGTVLGLEAVTANGNVLDMLGTLRKDNTGYDLKHLFIGSEGSLGIVTKVSILTQPKLSSVNLAFIACKDYLSCQKLLVEAKRNLGEILSAFEFLDNNSMDLVLNHLDGVRNPVSSSENFYILIETTGSDETNDREKLEAFLLKSLEKGLVSDGVIAQDINQASSFWRIREGITEALQKAGAVYKYDLSLPVEEIYNIVNDLRGRLGDLANVMGYGHLGDGNLHLNISAAEYNDKLLGLIEPYVYEWTSKHRGSISAEHGLGVMKANEIFYSKSPETVALMASIKKLLDPKGILNPYKVLPHSLFSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry