AibGenesis™ Mouse Anti-LCR60 Antibody (CBMOAB-35713FYC)


Cat: CBMOAB-35713FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35713FYC Monoclonal A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata) WB, ELISA MO35713FC 100 µg
MO-AB-00650H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00650C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata)
CloneMO35713FC
SpecificityThis antibody binds to Arabidopsis LCR60.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis LCR60 Antibody is a mouse antibody against LCR60. It can be used for LCR60 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDefensin-like protein 172; Low-molecular-weight cysteine-rich protein 60; Protein LCR60; LCR60; At2g20208
UniProt IDP82774
Protein RefseqThe length of the protein is 84 amino acids long. The sequence is show below: MAKASSTLVLSIIFLVMFALVEQNMGCTATMGPCEKDKSCSATCRATFGDRANGFCDYSTSTSPGGECTCVYHCPPVVPHESHL.
For Research Use Only | Not For Clinical Use.
Online Inquiry