Mouse Anti-Arabidopsis MATK Antibody (CBMOAB-36245FYC)
Cat: CBMOAB-36245FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO36245FC |
Specificity | This antibody binds to Arabidopsis MATK. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Chloroplast |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. |
Product Overview | Mouse Anti-Arabidopsis MATK Antibody is a mouse antibody against MATK. It can be used for MATK detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Megakaryocyte-Associated Tyrosine Kinase; Hematopoietic Consensus Tyrosine-Lacking Kinase; Tyrosine-Protein Kinase CTK; Protein Kinase HYL; Leukocyte Carboxyl-Terminal Src Kinase Related; Csk-Type Protein Tyrosine Kinase; Hydroxyaryl-Protein Kinase; Tyrosylprotein Kinase; Csk-Homologous Kinase; CSK Homologous Kinase; Tyrosine Kinase MATK |
UniProt ID | P56784 |
Protein Refseq | The length of the protein is 504 amino acids long. The sequence is show below: MDKFQGYLEFDGARQQSFLYPLFFREYIYVLAYDHGLNRLNRNRYIFLENADYDKKYSSLITKRLILRMYEQNRLIIPTKDVNQNSFLGHTSLFYYQMISVLFAVIVEIPFSLRLGSSFQGKQLKKSYNLQSIHSIFPFLEDKLGHFNYVLDVLIPYPIHLEILVQTLRYRVKDASSLHFFRFCLYEYCNWKNFYIKKKSILNPRFFLFLYNSHVCEYESIFFFLRKRSSHLRSTSYEVLFERIVFYGKIHHFFKVFVNNFPAILGLLKDPFIHYVRYHGRCILATKDTPLLMNKWKYYFVNLWQCYFSVWFQSQKVNINQLSKDNLEFLGYLSSLRLNPLVVRSQMLENSFLIDNVRIKLDSKIPISSIIGSLAKDKFCNVLGHPISKATWTDSSDSDILNRFVRICRNISHYYSGSSKKKNLYRIKYILRLCCVKTLARKHKSTVRTFLKRLGSGLLEEFLTGEDQVLSLIFPRSYYASKRLYRVRIWYLDILYLNDLVNHE. |
See other products for " matk "
CBMOAB-86095FYA | Mouse Anti-Zebrafish matk Antibody (CBMOAB-86095FYA) |
MO-AB-15395R | Mouse Anti-Cattle MATK Antibody (MO-AB-15395R) |
MO-AB-34870H | Mouse Anti-Tomato matK Antibody (MO-AB-34870H) |
MO-AB-58784W | Mouse Anti-Marmoset MATK Antibody (MO-AB-58784W) |
MO-AB-00306W | Mouse Anti-Barrel medic matK Antibody (MO-AB-00306W) |
MO-AB-04301W | Mouse Anti-Rhesus MATK Antibody (MO-AB-04301W) |
MO-AB-31874H | Mouse Anti-Soybean matK Antibody (MO-AB-31874H) |
MO-AB-28514W | Mouse Anti-Cucumber matK Antibody (MO-AB-28514W) |
MO-AB-30290H | Mouse Anti-Sugar beet matK Antibody (MO-AB-30290H) |
CBMOAB-50917FYA | Mouse Anti-Rhesus MATK Antibody (CBMOAB-50917FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry