Mouse Anti-matK Antibody (MO-AB-31874H)


Cat: MO-AB-31874H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-31874H Monoclonal Soybean (Glycine max), Arabidopsis (Arabidopsis lyrata), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cattle (Bos taurus), Cottonwood (Populus deltoids), Cucumber (Cucumis sativus), French-bean, Grape (Vitis vinifera), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Sugar beet (Beta vulgaris), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) WB, ELISA MO31874C 100 µg
CBMOAB-50917FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO50917FYA 100 µg
CBMOAB-86095FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86095FYA 100 µg
CBMOAB-34612FYB Monoclonal Rice (Oryza) WB, ELISA MO34612FYB 100 µg
MO-AB-00306W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00306W 100 µg
MO-AB-04301W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04301W 100 µg
MO-AB-27797W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27797W 100 µg
MO-AB-28514W Monoclonal Cucumber (Cucumis sativus) WB, ELISA MO28514W 100 µg
MO-AB-36279W Monoclonal French-bean WB, ELISA MO36279W 100 µg
MO-AB-39207W Monoclonal Grape (Vitis vinifera) WB, ELISA MO39207W 100 µg
MO-AB-58784W Monoclonal Marmoset WB, ELISA MO58784W 100 µg
MO-AB-15395R Monoclonal Cattle (Bos taurus) WB, ELISA MO15395R 100 µg
MO-AB-00672H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00672C 100 µg
MO-AB-30290H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30290C 100 µg
MO-AB-34870H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34870C 100 µg
MO-AB-01879L Monoclonal Bromus (Bromus vulgaris) WB, ELISA MO01879L 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySoybean (Glycine max), Arabidopsis (Arabidopsis lyrata), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cattle (Bos taurus), Cottonwood (Populus deltoids), Cucumber (Cucumis sativus), French-bean, Grape (Vitis vinifera), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), Sugar beet (Beta vulgaris), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio)
CloneMO31874C
SpecificityThis antibody binds to Soybean matK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene. (From NCBI)
Product OverviewThis product is a mouse antibody against matK. It can be used for matK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMaturase K; Intron maturase; matK
UniProt IDB1NK01
Protein RefseqThe length of the protein is 505 amino acids long.
The sequence is show below: MEESRAYLELHRSRHQDTLYPLFFRESIYGLACGHGSIFVENVGYNNKFSLLIVKRLITRMYQQTHFIIFTNDSNKNPFMGYNNHFYSQIILEGFVVVVEILFSLQFCISSLREFEIVKSYNNLRSIHSIFPFFEDKLIYLNHESDIRIPYPIHLEILVQILRYWIKDVSFFHLLRFFFSYYYNWNSIFTPKKWISTFFSKSNPRFFLFLYNLYVWEYESIFLFLRNKSSKLRLKYFRVFFERIFFYEKIEHLVEXSVKDCSYTLSFFKDTFMHYVRYQGKSILVSKNTPLLINKWKYYFIYLWQCHFDIWSRPGTIHINQLSQHSFHFLGYFLSIRPNLSVVRSQMLQNSFLIKMVMKRLDTIVPIIPLIRSLAKAKFCNVFGHPISKPVWANLSDFDIIDRFLRICRNFSHYYNGSAKKKSLYQIRYILRLSCIKTLARKHKSTARTFLKRLGSEKLLEEFFTEEEETFSLIFPRTSFTLQRLYIGRIWYLDILVRNDFVNHF.
See other products for " MATK "
For Research Use Only | Not For Clinical Use.
Online Inquiry