Mouse Anti-Arabidopsis matK Antibody (MO-AB-00672H)


Cat: MO-AB-00672H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityArabidopsis (Arabidopsis lyrata)
CloneMO00672C
SpecificityThis antibody binds to Arabidopsis matK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene.
Product OverviewThis product is a mouse antibody against matK. It can be used for matK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMaturase K; matK
UniProt IDD7KRD4
Protein RefseqThe length of the protein is 526 amino acids long.
The sequence is show below: MCHFRTQENKDFTFSSNRISIQMEKFQGYLEFDGARQQSFLYPLFFREYIYVLAYDHGLNRLNRNRSIFLENTDYDKKYSSLIVKRLILRMYEQNRLIIPTKDLNQNSFLGHTSLFYYQMISVLFAVIVEIPFSLRLGSSFQGKQFKKSYNLQSIHSIFPFLEDKLAHFNYVLDVLIPYPIHLEILVQILRYWVKDTSSLHFFRFCLYEYCNCKNFYIKKKSILNPRFFLFLYNSHVCEYESIFFFLRKRSSHLRSPSYEVLFERIFFYGKIEYFFKVFVNNFPAILGLLKDPFIHYVRYHGRCILATKDTPLLMNKWKYFFVNLWQCYFSVWFQSQKVNINQLSKDNLEFLGYLSSLRLNPLVVRSQMLENSFLIDNVRIKLDSKIPISSIIGSLAKDKFCNVLGHPISKATWTDSSDSDILNRFVRICRNISHYYSGSSKKKNLYRIKYILRLCCVKTLARKHKSTVRAFLKRLGSGLLEEFLTGEDQVLSLIFPRSYYASKRLYRVRIWYLDILYLNDLVNHE.
For Research Use Only | Not For Clinical Use.
Online Inquiry