Mouse Anti-ORC2 Antibody (CBMOAB-37837FYC)
Cat: CBMOAB-37837FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-37837FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Maize (Zea mays), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), S. cerevisiae, Silkworm (Bombyx mori), Yeast | WB, ELISA | MO37837FC | 100 µg | ||
| CBMOAB-26929FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO26929FYA | 100 µg | ||
| CBMOAB-53589FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO53589FYA | 100 µg | ||
| CBMOAB-02744CR | Monoclonal | Yeast | WB, ELISA | MO02744CR | 100 µg | ||
| CBMOAB-08045HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO08045HB | 100 µg | ||
| CBMOAB-41922FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO41922FYB | 100 µg | ||
| MO-AB-24024W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24024W | 100 µg | ||
| MO-AB-48997W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO48997W | 100 µg | ||
| MO-AB-60745W | Monoclonal | Marmoset | WB, ELISA | MO60745W | 100 µg | ||
| MO-AB-70180W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70180W | 100 µg | ||
| MO-AB-17341R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO17341R | 100 µg | ||
| MO-AB-05900H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05900C | 100 µg | ||
| MOFY-0922-FY16 | Monoclonal | S. cerevisiae | WB, IP, ELISA | MSB46 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Maize (Zea mays), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), S. cerevisiae, Silkworm (Bombyx mori), Yeast |
| Clone | MO37837FC |
| Specificity | This antibody binds to Arabidopsis ORC2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. This protein forms a core complex with ORC3, -4, and -5. It also interacts with CDC45 and MCM10, which are proteins known to be important for the initiation of DNA replication. This protein has been demonstrated to specifically associate with the origin of replication of Epstein-Barr virus in human cells, and is thought to be required for DNA replication from viral origin of replication. Alternatively spliced transcript variants have been found, one of which is a nonsense-mediated mRNA decay candidate. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis ORC2 Antibody is a mouse antibody against ORC2. It can be used for ORC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Origin Recognition Complex Subunit 2; ORC2L; Origin Recognition Complex, Subunit 2 (Yeast Homolog)-Like; Origin Recognition Complex, Subunit 2 Homolog (Yeast); Origin Recognition Complex, Subunit 2-Like (Yeast); Origin Recognition Complex, Subunit 2 Homolog; Origin Recognition Complex Protein 2 Homolog; Origin Recognition Complex, Subunit 2 |
| UniProt ID | Q38899 |
| Protein Refseq | The length of the protein is 363 amino acids long. The sequence is show below: MEDIENIEEDEYGFSRNYFLAKELGGASKRSAHKLSDIHIVDEQELRETASTIEMKHSKEISELMSDYKTMYSKWVFELRCGFGLLMYGFGSKKALVEDFASASLTDYSVVVINGYLPSVNLKQVLLALAELLSELLKCKRKSSGSLSKGQETFPSRSMDDILSFLHGPQSGDKDCFICVVVHNIDGPALRDPESQQTLARLSSCSHIRLVASIDHVNAPLLWDKKMVHKQFNWLWHHVPTFAPYNVEGVFFPLVLAQGSTAQTAKTAAIVLQSLTPNGQNVFKILAEYQLSHPDEDGMPTDDLYSASRERFFVSSQVTLNSHLTEFKDHELVKTKRNSDGQECLNIPLTSDAIRQLLLDLNQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry