Mouse Anti-ORC2 Antibody (CBMOAB-37837FYC)


Cat: CBMOAB-37837FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-37837FYC Monoclonal A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Maize (Zea mays), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), S. cerevisiae, Silkworm (Bombyx mori), Yeast WB, ELISA MO37837FC 100 µg
CBMOAB-26929FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO26929FYA 100 µg
CBMOAB-53589FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO53589FYA 100 µg
CBMOAB-02744CR Monoclonal Yeast WB, ELISA MO02744CR 100 µg
CBMOAB-08045HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO08045HB 100 µg
CBMOAB-41922FYB Monoclonal Rice (Oryza) WB, ELISA MO41922FYB 100 µg
MO-AB-24024W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24024W 100 µg
MO-AB-48997W Monoclonal Maize (Zea mays) WB, ELISA MO48997W 100 µg
MO-AB-60745W Monoclonal Marmoset WB, ELISA MO60745W 100 µg
MO-AB-70180W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70180W 100 µg
MO-AB-17341R Monoclonal Cattle (Bos taurus) WB, ELISA MO17341R 100 µg
MO-AB-05900H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05900C 100 µg
MOFY-0922-FY16 Monoclonal S. cerevisiae WB, IP, ELISA MSB46 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Maize (Zea mays), Marmoset, Rhesus (Macaca mulatta), Rice (Oryza), S. cerevisiae, Silkworm (Bombyx mori), Yeast
CloneMO37837FC
SpecificityThis antibody binds to Arabidopsis ORC2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. This protein forms a core complex with ORC3, -4, and -5. It also interacts with CDC45 and MCM10, which are proteins known to be important for the initiation of DNA replication. This protein has been demonstrated to specifically associate with the origin of replication of Epstein-Barr virus in human cells, and is thought to be required for DNA replication from viral origin of replication. Alternatively spliced transcript variants have been found, one of which is a nonsense-mediated mRNA decay candidate.
Product OverviewMouse Anti-Arabidopsis ORC2 Antibody is a mouse antibody against ORC2. It can be used for ORC2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOrigin Recognition Complex Subunit 2; ORC2L; Origin Recognition Complex, Subunit 2 (Yeast Homolog)-Like; Origin Recognition Complex, Subunit 2 Homolog (Yeast); Origin Recognition Complex, Subunit 2-Like (Yeast); Origin Recognition Complex, Subunit 2 Homolog; Origin Recognition Complex Protein 2 Homolog; Origin Recognition Complex, Subunit 2
UniProt IDQ38899
Protein RefseqThe length of the protein is 363 amino acids long. The sequence is show below: MEDIENIEEDEYGFSRNYFLAKELGGASKRSAHKLSDIHIVDEQELRETASTIEMKHSKEISELMSDYKTMYSKWVFELRCGFGLLMYGFGSKKALVEDFASASLTDYSVVVINGYLPSVNLKQVLLALAELLSELLKCKRKSSGSLSKGQETFPSRSMDDILSFLHGPQSGDKDCFICVVVHNIDGPALRDPESQQTLARLSSCSHIRLVASIDHVNAPLLWDKKMVHKQFNWLWHHVPTFAPYNVEGVFFPLVLAQGSTAQTAKTAAIVLQSLTPNGQNVFKILAEYQLSHPDEDGMPTDDLYSASRERFFVSSQVTLNSHLTEFKDHELVKTKRNSDGQECLNIPLTSDAIRQLLLDLNQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry