AibGenesis™ Mouse Anti-PETG Antibody (CBMOAB-38633FYC)
Cat: CBMOAB-38633FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-38633FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Cottonwood (Populus deltoids), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) | WB, ELISA | MO38633FC | 100 µg | ||
| CBMOAB-88563FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88563FYB | 100 µg | ||
| MO-AB-00468W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00468W | 100 µg | ||
| MO-AB-27870W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27870W | 100 µg | ||
| MO-AB-30477H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30477C | 100 µg | ||
| MO-AB-39370W | Monoclonal | Grape (Vitis vinifera) | WB, ELISA | MO39370W | 100 µg | ||
| MO-DKB-02711W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Cottonwood (Populus deltoids), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO38633FC |
| Specificity | This antibody binds to Arabidopsis PETG. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetG is required for either the stability or assembly of the cytochrome b6-f complex. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis PETG Antibody is a mouse antibody against PETG. It can be used for PETG detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome b6-f complex subunit 5; Cytochrome b6-f complex subunit PetG; Cytochrome b6-f complex subunit V; petG; AtCg00600 |
| UniProt ID | P56775 |
| Protein Refseq | The length of the protein is 37 amino acids long. The sequence is show below: MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry