AibGenesis™ Mouse Anti-PETG Antibody (CBMOAB-38633FYC)


Cat: CBMOAB-38633FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38633FYC Monoclonal A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Cottonwood (Populus deltoids), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris) WB, ELISA MO38633FC 100 µg
CBMOAB-88563FYB Monoclonal Rice (Oryza) WB, ELISA MO88563FYB 100 µg
MO-AB-00468W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00468W 100 µg
MO-AB-27870W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27870W 100 µg
MO-AB-30477H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30477C 100 µg
MO-AB-39370W Monoclonal Grape (Vitis vinifera) WB, ELISA MO39370W 100 µg
MO-DKB-02711W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Cottonwood (Populus deltoids), Grape (Vitis vinifera), Rice (Oryza), Sugar beet (Beta vulgaris)
CloneMO38633FC
SpecificityThis antibody binds to Arabidopsis PETG.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetG is required for either the stability or assembly of the cytochrome b6-f complex. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Arabidopsis PETG Antibody is a mouse antibody against PETG. It can be used for PETG detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b6-f complex subunit 5; Cytochrome b6-f complex subunit PetG; Cytochrome b6-f complex subunit V; petG; AtCg00600
UniProt IDP56775
Protein RefseqThe length of the protein is 37 amino acids long. The sequence is show below: MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDF.
For Research Use Only | Not For Clinical Use.
Online Inquiry