Mouse Anti-PK2 Antibody (CBMOAB-38931FYC)
Cat: CBMOAB-38931FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-38931FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Rice (Oryza), Shrimp white spot syndrome virus | WB, ELISA | MO38931FC | 100 µg | ||
| CBMOAB-88750FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88750FYB | 100 µg | ||
| MO-AB-30174H | Monoclonal | Shrimp white spot syndrome virus | WB, ELISA | MO30174C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Rice (Oryza), Shrimp white spot syndrome virus |
| Clone | MO38931FC |
| Specificity | This antibody binds to Arabidopsis PK2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PK2 Antibody is a mouse antibody against PK2. It can be used for PK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative uncharacterized protein PK2; Fragment; PK2 |
| UniProt ID | P93035 |
| Protein Refseq | The length of the protein is 47 amino acids long. The sequence is show below: EFNPKLSDFGLAKVGPTGDRTHVSTQVMGTQGYAAPEYVATGRITAE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry