Mouse Anti-PK2 Antibody (CBMOAB-38931FYC)


Cat: CBMOAB-38931FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38931FYC Monoclonal A. thaliana (Arabidopsis thaliana), Rice (Oryza), Shrimp white spot syndrome virus WB, ELISA MO38931FC 100 µg
Inquiry
CBMOAB-88750FYB Monoclonal Rice (Oryza) WB, ELISA MO88750FYB 100 µg
Inquiry
MO-AB-30174H Monoclonal Shrimp white spot syndrome virus WB, ELISA MO30174C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Rice (Oryza), Shrimp white spot syndrome virus
CloneMO38931FC
SpecificityThis antibody binds to Arabidopsis PK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis PK2 Antibody is a mouse antibody against PK2. It can be used for PK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative uncharacterized protein PK2; Fragment; PK2
UniProt IDP93035
Protein RefseqThe length of the protein is 47 amino acids long. The sequence is show below: EFNPKLSDFGLAKVGPTGDRTHVSTQVMGTQGYAAPEYVATGRITAE.
For Research Use Only | Not For Clinical Use.
Online Inquiry