AibGenesis™ Mouse Anti-PSAI Antibody (CBMOAB-39394FYC)
Cat: CBMOAB-39394FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39394FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Maize (Zea mays), Rice (Oryza), Sugar beet (Beta vulgaris) | WB, ELISA | MO39394FC | 100 µg | ||
| CBMOAB-88918FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO88918FYB | 100 µg | ||
| MO-AB-00505W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00505W | 100 µg | ||
| MO-AB-01905L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01905L | 100 µg | ||
| MO-AB-27983W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27983W | 100 µg | ||
| MO-AB-30484H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30484C | 100 µg | ||
| MO-AB-36418W | Monoclonal | French-bean | WB, ELISA | MO36418W | 100 µg | ||
| MO-AB-49373W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO49373W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), Cottonwood (Populus deltoids), French-bean, Maize (Zea mays), Rice (Oryza), Sugar beet (Beta vulgaris) |
| Clone | MO39394FC |
| Specificity | This antibody binds to Arabidopsis PSAI. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis PSAI Antibody is a mouse antibody against PSAI. It can be used for PSAI detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Photosystem I reaction center subunit VIII; PSI-I; psaI; AtCg00510 |
| UniProt ID | P56768 |
| Protein Refseq | The length of the protein is 37 amino acids long. The sequence is show below: MTTFNNLPSIFVPLVGLVFPAIAMASLFLHIQKNKIF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry