Mouse Anti-Arabidopsis RIC3 Antibody (MO-AB-00881H)


Cat: MO-AB-00881H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityArabidopsis (Arabidopsis lyrata)
CloneMO00881C
SpecificityThis antibody binds to Arabidopsis RIC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the resistance to inhibitors of cholinesterase 3-like family which functions as a chaperone of specific 5-hydroxytryptamine type 3 receptor and nicotinic acetylcholine receptor subtypes. The encoded protein influences the folding and assembly of these receptor subunits in the endoplasmic reticulum and expression on the cell surface. This protein contains an N-terminal transmembrane domain, a proline-rich spacer, and a cytosolic C-terminal coiled-coil domain. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against RIC3. It can be used for RIC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRop-interactive crib motif-containing protein 3; RIC3
UniProt IDD7KDE9
Protein RefseqThe length of the protein is 219 amino acids long.
The sequence is show below: MTTVKGLLKGLRYITQIFDEDKDKDMQIGFPTDVKHVAHIGSDGPAANMPSWMGDFRPQDNENGQVVSRGDANNNQIGEGVGLQELLPPTEKPKHKKTRRKSETVSQNGSPPRRNSSASASDMQPKHPRRHHRSRHGSIDSSNDPSVRRRRAVSVTTDMEGSYPLSDSSTHTRKSTSRHRKPKESGGGELSMKKTKGKTENPIVQSVDKCNDNNISDKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry