Mouse Anti-Arabidopsis RIC4 Antibody (MO-AB-00882H)


Cat: MO-AB-00882H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityArabidopsis (Arabidopsis lyrata)
CloneMO00882C
SpecificityThis antibody binds to Arabidopsis RIC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFunctions as downstream effector of Rho-related GTP binding proteins of the ''Rho of Plants'' (ROPs) family. Participates in the propagation of ROP GTPase signals in specific cellular responses. Required for actin cortical microfilament assembly. Activated by ARAC4/ROP2 to promote the assembly of cortical actin microfilaments required for lobe formation and lateral expansion of pavement cells. Interaction with, and activation by ARAC4/ROP2 is inhibited by RIC1. Functions as downstream effector of ARAC11/ROP1 to promote the assembly of apical F-actin associated with vesicle accumulation in the tip of the growing pollen tube. Counteracts the ARAC11/ROP1-RIC3 pathway, which activates calcium signaling that leads to apical F-actin disassembly associated with exocytosis, to control actin dynamics and pollen tube apical growth. Downstream of ARAC11/ROP1, is involved in the growth responses to the root-colonizing endophytic fungus P.indica.
Product OverviewThis product is a mouse antibody against RIC4. It can be used for RIC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRop-interactive crib motif-containing protein 4; RIC4
UniProt IDD7M853
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MRDRMERLVVLPFSVGCISDSSVAVLSPLSKPHHHHSRQESRDQEEEDNMKSVFKFLALSKPEISTGINRLFKSFKTISQLFADKEEENEEVETSGMEIGVPTNVKHVSHIGWESGLTAATGPGKGWEDLIPPELLAAASTKKDVNPHLHPTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry