Mouse Anti-Arabidopsis RPL28 Antibody (CBMOAB-40403FYC)
Cat: CBMOAB-40403FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana) |
Clone | MO40403FC |
Specificity | This antibody binds to Arabidopsis RPL28. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Chloroplast; Endoplasmic reticulum; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L28E family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Product Overview | Mouse Anti-Arabidopsis RPL28 Antibody is a mouse antibody against RPL28. It can be used for RPL28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ribosomal Protein L28; Large Ribosomal Subunit Protein EL28; 0S Ribosomal Protein L28; L28 |
UniProt ID | O22795 |
Protein Refseq | The length of the protein is 143 amino acids long. The sequence is show below: MTTMATQGAWLRMTSSAKSMTKSTVTSKELGFLTSQLSGLRISYTPSDVINRISLPSFPGIQPIVARRICPFTGKKANRANKVSFSNHKTKKLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKNGLDAVAKKAGIDLRKK. |
See other products for " RPL28 "
MO-AB-05719W | Mouse Anti-Rhesus RPL28 Antibody (MO-AB-05719W) |
MO-AB-70314W | Mouse Anti-Silkworm RpL28 Antibody (MO-AB-70314W) |
MO-AB-07240H | Mouse Anti-Frog rpl28 Antibody (MO-AB-07240H) |
CBMOAB-03522CR | Mouse Anti-Yeast RPL28 Antibody (CBMOAB-03522CR) |
MO-AB-28612H | Mouse Anti-Rat Rpl28 Antibody (MO-AB-28612H) |
CBMOAB-09306HCB | Mouse Anti-C. elegans RPL28 Antibody (CBMOAB-09306HCB) |
CBMOAB-29996FYA | Mouse Anti-D. melanogaster Rpl28 Antibody (CBMOAB-29996FYA) |
MO-AB-19500R | Mouse Anti-Cattle RPL28 Antibody (MO-AB-19500R) |
CBMOAB-96427FYA | Mouse Anti-Zebrafish rpl28 Antibody (CBMOAB-96427FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry