AibGenesis™ Mouse Anti-RUB3 Antibody (CBMOAB-40928FYC)
Cat: CBMOAB-40928FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Rice (Oryza) |
| Clone | MO40928FC |
| Specificity | This antibody binds to Arabidopsis RUB3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Arabidopsis RUB3 Antibody is a mouse antibody against RUB3. It can be used for RUB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | NEDD8-like protein RUB3; Ubiquitin-related protein 3; AtRUB3; RUB3; UBQ16; At1g11980 |
| UniProt ID | O65381 |
| Protein Refseq | The length of the protein is 78 amino acids long. The sequence is show below: MEIKVKTLTEKQIDIEIELTDTIERIKERIEEKEGIPPVHQRIVYTGKQLADDLTAKHYNLERGSVLHLVLALRGGCC. |
For Research Use Only | Not For Clinical Use.
Online Inquiry