AibGenesis™ Mouse Anti-RUB3 Antibody (CBMOAB-40928FYC)


Cat: CBMOAB-40928FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40928FYC Monoclonal A. thaliana (Arabidopsis thaliana), Rice (Oryza) WB, ELISA MO40928FC 100 µg
CBMOAB-89280FYB Monoclonal Rice (Oryza) WB, ELISA MO89280FYB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Rice (Oryza)
CloneMO40928FC
SpecificityThis antibody binds to Arabidopsis RUB3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Arabidopsis RUB3 Antibody is a mouse antibody against RUB3. It can be used for RUB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNEDD8-like protein RUB3; Ubiquitin-related protein 3; AtRUB3; RUB3; UBQ16; At1g11980
UniProt IDO65381
Protein RefseqThe length of the protein is 78 amino acids long. The sequence is show below: MEIKVKTLTEKQIDIEIELTDTIERIKERIEEKEGIPPVHQRIVYTGKQLADDLTAKHYNLERGSVLHLVLALRGGCC.
For Research Use Only | Not For Clinical Use.
Online Inquiry