AibGenesis™ Mouse Anti-VDAC3 Antibody (CBMOAB-45819FYC)
Cat: CBMOAB-45819FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45819FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) | WB, ELISA | MO45819FC | 100 µg | ||
| CBMOAB-62069FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO62069FYA | 100 µg | ||
| CBMOAB-15749FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO15749FYB | 100 µg | ||
| CBMOAB-89807FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89807FYB | 100 µg | ||
| MO-AB-14523W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14523W | 100 µg | ||
| MO-AB-47058W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO47058W | 100 µg | ||
| MO-AB-67651W | Monoclonal | Marmoset | WB, ELISA | MO67651W | 100 µg | ||
| MO-AB-22765R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22765R | 100 µg | ||
| MO-AB-31187R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31187R | 100 µg | ||
| MO-AB-09026H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO09026C | 100 µg | ||
| MO-AB-10460Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10460Y | 100 µg | ||
| MO-DKB-02531W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Rice (Oryza), Zebrafish (Danio rerio) |
| Clone | MO45819FC |
| Specificity | This antibody binds to Arabidopsis VDAC3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Vacuole; Chloroplast; Plasma membrane; Cell Wall; Other locations; Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kinases of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Alternatively transcript variants encoding different isoforms have been described for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis VDAC3 Antibody is a mouse antibody against VDAC3. It can be used for VDAC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Voltage Dependent Anion Channel 3; Outer Mitochondrial Membrane Protein Porin 3; VDAC-3; Voltage-Dependent Anion-Selective Channel Protein 3; HD-VDAC3; HVDAC3 |
| UniProt ID | Q9SMX3 |
| Protein Refseq | The length of the protein is 274 amino acids long. The sequence is show below: MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQVKNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGEKLNASYYQIVSPSTVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANALIQHEWRPKSFFTVSGEVDSKAIDKSAKVGIALALKP. |
Reference
| Reference | 1. Hemono, M., Ubrig, É., Azeredo, K., Salinas-Giegé, T., Drouard, L., & Duchêne, A. M. (2020). Arabidopsis voltage-dependent anion channels (VDACs): overlapping and specific functions in mitochondria. Cells, 9(4), 1023. 2. Kwon, T. (2016). Mitochondrial porin isoform AtVDAC1 regulates the competence of Arabidopsis thaliana to Agrobacterium-mediated genetic transformation. Molecules and Cells, 39(9), 705. 3. Kanwar, P., Sanyal, S. K., Mahiwal, S., Ravi, B., Kaur, K., Fernandes, J. L., ... & Pandey, G. K. (2022). CIPK9 targets VDAC3 and modulates oxidative stress responses in Arabidopsis. The Plant Journal, 109(1), 241-260. |
See other products for " VDAC3 "
For Research Use Only | Not For Clinical Use.
Online Inquiry