Mouse Anti-ARF1 Antibody (CBMOAB-00290CR)
Cat: CBMOAB-00290CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00290CR | Monoclonal | WB, ELISA | MO00290CR | 100 µg | |||
CBMOAB-18648FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO18648FYB | 100 µg | ||
CBMOAB-2418FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO2418FC | 100 µg | ||
CBMOAB-66278FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66278FYA | 100 µg | ||
MO-AB-00036W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00036W | 100 µg | ||
MO-AB-01528H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01528C | 100 µg | ||
MO-AB-07535R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07535R | 100 µg | ||
MO-AB-10649Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10649Y | 100 µg | ||
MO-AB-14229Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14229Y | 100 µg | ||
MO-AB-17202W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17202W | 100 µg | ||
MO-AB-23849R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23849R | 100 µg | ||
MO-AB-24137H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24137C | 100 µg | ||
MO-AB-47362W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO47362W | 100 µg | ||
MO-AB-51151W | Monoclonal | Marmoset | WB, ELISA | MO51151W | 100 µg | ||
MO-DKB-0049RA | Polyclonal | IF, IG, WB | 50 µL | ||||
MO-DKB-01762W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
MOFAB-187W | Polyclonal | Arabidopsis, Canola, Barley, Gossypium Arboreum, Spinach, Chili, Carrot, Cucumber | WB, IF | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); C. reinhardtii (Chlamydomonas reinhardtii); M. truncatula (Medicago truncatula); N. tabacum (Nicotiana tabacum); Rice (Oryza); P. patens (Physcomitrium patens); S. tuberosum (Solanum tuberosum), Arabidopsis, Canola, Barley, Gossypium Arboreum, Spinach, Chili, Carrot, Cucumber, Barrel medic (Medicago truncatula), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Maize (Zea mays), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rice (Oryza), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO00290CR |
Specificity | This antibody binds to Yeast ARF1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma Membrane; Other locations; Golgi apparatus; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Recruits polyadenylate-binding protein PAB1 to COPI vesicles, and this is required for correct localization of the asymmetrically distributed ASH1 mRNA. |
Product Overview | Mouse Anti-Yeast ARF1 Antibody is a mouse antibody against ARF1. It can be used for ARF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ADP-ribosylation factor 1; ARF1; YDL192W |
UniProt ID | P11076 |
Protein Refseq | The length of the protein is 181 amino acids long. The sequence is show below: MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKNST. |
For Research Use Only | Not For Clinical Use.
Online Inquiry