Mouse Anti-ARF3 Antibody (CBMOAB-00292CR)
Cat: CBMOAB-00292CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00292CR | Monoclonal | Yeast, A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Maize (Zea mays), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rice (Oryza), Sheep (Ovis aries), Tomato (Lycopersicon esculentum) | WB, ELISA | MO00292CR | 100 µg | ||
CBMOAB-00610HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO00610HB | 100 µg | ||
CBMOAB-18666FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO18666FYB | 100 µg | ||
CBMOAB-2529FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO2529FC | 100 µg | ||
MO-AB-00080H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00080C | 100 µg | ||
MO-AB-01531H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01531C | 100 µg | ||
MO-AB-07537R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07537R | 100 µg | ||
MO-AB-14230Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14230Y | 100 µg | ||
MO-AB-23124W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23124W | 100 µg | ||
MO-AB-23852R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23852R | 100 µg | ||
MO-AB-24139H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24139C | 100 µg | ||
MO-AB-34183H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO34183C | 100 µg | ||
MO-AB-47389W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO47389W | 100 µg | ||
MO-AB-51152W | Monoclonal | Marmoset | WB, ELISA | MO51152W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Maize (Zea mays), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rice (Oryza), Sheep (Ovis aries), Tomato (Lycopersicon esculentum) |
Clone | MO00292CR |
Specificity | This antibody binds to Yeast ARF3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Golgi apparatus; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. |
Product Overview | Mouse Anti-Yeast ARF3 Antibody is a mouse antibody against ARF3. It can be used for ARF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ADP-ribosylation factor 3; ARF3; YOR094W |
UniProt ID | P40994 |
Protein Refseq | The length of the protein is 183 amino acids long. The sequence is show below: MGNSISKVLGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWISNNTNVPKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry