AibGenesis™ Mouse Anti-ARF4 Antibody (CBMOAB-0761FYC)


Cat: CBMOAB-0761FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-0761FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Maize (Zea mays), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rice, Rice (Oryza), Sheep (Ovis aries), Tomato (Lycopersicon esculentum) WB, ELISA MO0761FC 100 µg
CBMOAB-18667FYB Monoclonal Rice (Oryza) WB, ELISA MO18667FYB 100 µg
MO-AB-17972W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17972W 100 µg
MO-AB-47393W Monoclonal Maize (Zea mays) WB, ELISA MO47393W 100 µg
MO-AB-51153W Monoclonal Marmoset WB, ELISA MO51153W 100 µg
MO-AB-07538R Monoclonal Cattle (Bos taurus) WB, ELISA MO07538R 100 µg
MO-AB-23853R Monoclonal Pig (Sus scrofa) WB, ELISA MO23853R 100 µg
MO-AB-01532H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01532C 100 µg
MO-AB-24140H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24140C 100 µg
MO-AB-34184H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34184C 100 µg
MO-AB-10650Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10650Y 100 µg
MO-AB-14231Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14231Y 100 µg
MO-MMB-0476 Polyclonal Rice ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Maize (Zea mays), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rice, Rice (Oryza), Sheep (Ovis aries), Tomato (Lycopersicon esculentum)
CloneMO0761FC
SpecificityThis antibody binds to Arabidopsis ARF4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 5 ARF proteins and 11 ARF-like proteins and constitute one family of the RAS superfamily. The ARF proteins are categorized as class I, class II and class III; this gene is a class II member. The members of each class share a common gene organization. The ARF4 gene spans approximately 12kb and contains six exons and five introns. This gene is the most divergent member of the human ARFs. Conflicting map positions at 3p14 or 3p21 have been reported for this gene. (From NCBI)
Product OverviewMouse Anti-Arabidopsis ARF4 Antibody is a mouse antibody against ARF4. It can be used for ARF4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADP Ribosylation Factor 4; ADP-Ribosylation Factor 2; ARF2; ADP-Ribosylation Factor 4
UniProt IDE1A6J7
Protein RefseqThe length of the protein is 221 amino acids long. The sequence is show below: VRWDESFVSDHQERVSPWEIDPSVSLPHLSIQSSPRPKRPWAGLLDTTPPGNPITKRGGFLDFEESVRPSKVLQGQENIGSASPSQGFDVMNRRILDFAMQSHANPVLVSSRVKDRFGEFVDATGVNPACSGVMDLDRFPRVLQGQEICSLKSFPQFAGFSPAAAPNPFAYQANKSSYYPLALHGIRSTHVPYQNPYNAGNQTSGPPSRAINFGEETRKFD.
For Research Use Only | Not For Clinical Use.
Online Inquiry