Mouse Anti-ARF4 Antibody (CBMOAB-0761FYC)
Cat: CBMOAB-0761FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-0761FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Maize (Zea mays), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rice, Rice (Oryza), Sheep (Ovis aries), Tomato (Lycopersicon esculentum) | WB, ELISA | MO0761FC | 100 µg | ||
CBMOAB-18667FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO18667FYB | 100 µg | ||
MO-AB-17972W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17972W | 100 µg | ||
MO-AB-47393W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO47393W | 100 µg | ||
MO-AB-51153W | Monoclonal | Marmoset | WB, ELISA | MO51153W | 100 µg | ||
MO-AB-07538R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07538R | 100 µg | ||
MO-AB-23853R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23853R | 100 µg | ||
MO-AB-01532H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01532C | 100 µg | ||
MO-AB-24140H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24140C | 100 µg | ||
MO-AB-34184H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO34184C | 100 µg | ||
MO-AB-10650Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10650Y | 100 µg | ||
MO-AB-14231Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14231Y | 100 µg | ||
MO-MMB-0476 | Polyclonal | Rice | ELISA, WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Maize (Zea mays), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Rice, Rice (Oryza), Sheep (Ovis aries), Tomato (Lycopersicon esculentum) |
Clone | MO0761FC |
Specificity | This antibody binds to Arabidopsis ARF4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 5 ARF proteins and 11 ARF-like proteins and constitute one family of the RAS superfamily. The ARF proteins are categorized as class I, class II and class III; this gene is a class II member. The members of each class share a common gene organization. The ARF4 gene spans approximately 12kb and contains six exons and five introns. This gene is the most divergent member of the human ARFs. Conflicting map positions at 3p14 or 3p21 have been reported for this gene. |
Product Overview | Mouse Anti-Arabidopsis ARF4 Antibody is a mouse antibody against ARF4. It can be used for ARF4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ADP Ribosylation Factor 4; ADP-Ribosylation Factor 2; ARF2; ADP-Ribosylation Factor 4 |
UniProt ID | E1A6J7 |
Protein Refseq | The length of the protein is 221 amino acids long. The sequence is show below: VRWDESFVSDHQERVSPWEIDPSVSLPHLSIQSSPRPKRPWAGLLDTTPPGNPITKRGGFLDFEESVRPSKVLQGQENIGSASPSQGFDVMNRRILDFAMQSHANPVLVSSRVKDRFGEFVDATGVNPACSGVMDLDRFPRVLQGQEICSLKSFPQFAGFSPAAAPNPFAYQANKSSYYPLALHGIRSTHVPYQNPYNAGNQTSGPPSRAINFGEETRKFD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry