Mouse Anti-ARF6 Antibody (CBMOAB-00611HCB)
Cat: CBMOAB-00611HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00611HCB | Monoclonal | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio), Maize (Zea mays), Pig (Sus scrofa), Rice (Oryza), Tomato (Lycopersicon esculentum) | WB, ELISA | MO00611HB | 100 µg | ||
CBMOAB-0762FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO0762FC | 100 µg | ||
CBMOAB-18669FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO18669FYB | 100 µg | ||
MO-AB-01534H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01534C | 100 µg | ||
MO-AB-14233Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14233Y | 100 µg | ||
MO-AB-17874W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17874W | 100 µg | ||
MO-AB-23856R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23856R | 100 µg | ||
MO-AB-24142H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24142C | 100 µg | ||
MO-AB-34186H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO34186C | 100 µg | ||
MO-AB-47395W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO47395W | 100 µg | ||
MO-DKB-03338W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, IHC, IHC-P | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio), Maize (Zea mays), Pig (Sus scrofa), Rice (Oryza), Tomato (Lycopersicon esculentum) |
Clone | MO00611HB |
Specificity | This antibody binds to C. elegans ARF6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Endosome; Plasma Membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. |
Product Overview | Mouse Anti-C. elegans ARF6 Antibody is a mouse antibody against ARF6. It can be used for ARF6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein ARF-6; arf-6 |
Gene ID | 191608 |
UniProt ID | Q9U2S4 |
Protein Refseq | The length of the protein is 175 amino acids long. The sequence is show below: MGKFLSKIFGKKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRIRDRNWYVQPSCASTGDGLHEGLTWLSQNCKP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry