Mouse Anti-ARF6 Antibody (CBMOAB-00611HCB)


Cat: CBMOAB-00611HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00611HCB Monoclonal C. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio), Maize (Zea mays), Pig (Sus scrofa), Rice (Oryza), Tomato (Lycopersicon esculentum) WB, ELISA MO00611HB 100 µg
CBMOAB-0762FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO0762FC 100 µg
CBMOAB-18669FYB Monoclonal Rice (Oryza) WB, ELISA MO18669FYB 100 µg
MO-AB-01534H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01534C 100 µg
MO-AB-14233Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14233Y 100 µg
MO-AB-17874W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17874W 100 µg
MO-AB-23856R Monoclonal Pig (Sus scrofa) WB, ELISA MO23856R 100 µg
MO-AB-24142H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24142C 100 µg
MO-AB-34186H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34186C 100 µg
MO-AB-47395W Monoclonal Maize (Zea mays) WB, ELISA MO47395W 100 µg
MO-DKB-03338W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), A. thaliana (Arabidopsis thaliana), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcllus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio), Maize (Zea mays), Pig (Sus scrofa), Rice (Oryza), Tomato (Lycopersicon esculentum)
CloneMO00611HB
SpecificityThis antibody binds to C. elegans ARF6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Plasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. (From NCBI)
Product OverviewMouse Anti-C. elegans ARF6 Antibody is a mouse antibody against ARF6. It can be used for ARF6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein ARF-6; arf-6
Gene ID191608
UniProt IDQ9U2S4
Protein RefseqThe length of the protein is 175 amino acids long. The sequence is show below: MGKFLSKIFGKKELRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRIRDRNWYVQPSCASTGDGLHEGLTWLSQNCKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry