Mouse Anti-Arfgap1 Antibody (CBMOAB-01167FYA)


Cat: CBMOAB-01167FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-01167FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO01167FYA 100 µg
CBMOAB-36124FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36124FYA 100 µg
CBMOAB-66294FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66294FYA 100 µg
MO-AB-01099W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01099W 100 µg
MO-AB-01536H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01536C 100 µg
MO-AB-07540R Monoclonal Cattle (Bos taurus) WB, ELISA MO07540R 100 µg
MO-AB-13736W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13736W 100 µg
MO-AB-51157W Monoclonal Marmoset WB, ELISA MO51157W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO01167FYA
SpecificityThis antibody binds to fruit fly Arfgap1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a GTPase-activating protein, which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Arfgap1 Antibody is a mouse antibody against Arfgap1. It can be used for Arfgap1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADP-ribosylation factor GTPase activating protein 1, isoform B; ArfGAP1
UniProt IDM9PFF1
Protein RefseqThe length of the protein is 448 amino acids long.
The sequence is show below: MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQGKSWDLKEAQGRVGSNNSFSSGGSSNSSYQSRPSATGYGGNGGYQNGGGAEPGGYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFDSTLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKVTDMGKRGWNNLAGSNISSPQGGYNDPNFEDSSAYQRSNSVGGNLAGGLGQQSGVSDSDWGGWQDNGNSKSHMTSSSSYHNQLSSSSGGGTASAGLTRDADWSGFEATNYQSSETSYQNASSGGSTARRNMKLQDTSQKLSEGFESLDVKSVKPKTATASSANKGTAEDDAWNLLMN.
For Research Use Only | Not For Clinical Use.
Online Inquiry