Mouse Anti-Arfgap1 Antibody (CBMOAB-01167FYA)
Cat: CBMOAB-01167FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-01167FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO01167FYA | 100 µg | ||
| CBMOAB-36124FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36124FYA | 100 µg | ||
| CBMOAB-66294FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66294FYA | 100 µg | ||
| MO-AB-01099W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01099W | 100 µg | ||
| MO-AB-01536H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01536C | 100 µg | ||
| MO-AB-07540R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07540R | 100 µg | ||
| MO-AB-13736W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13736W | 100 µg | ||
| MO-AB-51157W | Monoclonal | Marmoset | WB, ELISA | MO51157W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO01167FYA |
| Specificity | This antibody binds to fruit fly Arfgap1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Golgi apparatus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a GTPase-activating protein, which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1. The encoded protein promotes hydrolysis of ADP-ribosylation factor 1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-D. melanogaster Arfgap1 Antibody is a mouse antibody against Arfgap1. It can be used for Arfgap1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ADP-ribosylation factor GTPase activating protein 1, isoform B; ArfGAP1 |
| UniProt ID | M9PFF1 |
| Protein Refseq | The length of the protein is 448 amino acids long. The sequence is show below: MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVRSVTMDKWKDIELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQGKSWDLKEAQGRVGSNNSFSSGGSSNSSYQSRPSATGYGGNGGYQNGGGAEPGGYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFDSTLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKVTDMGKRGWNNLAGSNISSPQGGYNDPNFEDSSAYQRSNSVGGNLAGGLGQQSGVSDSDWGGWQDNGNSKSHMTSSSSYHNQLSSSSGGGTASAGLTRDADWSGFEATNYQSSETSYQNASSGGSTARRNMKLQDTSQKLSEGFESLDVKSVKPKTATASSANKGTAEDDAWNLLMN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry