AibGenesis™ Mouse Anti-Arfrp1 Antibody (CBMOAB-01174FYA)


Cat: CBMOAB-01174FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-01174FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO01174FYA 100 µg
CBMOAB-36130FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36130FYA 100 µg
CBMOAB-66316FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66316FYA 100 µg
MO-AB-01541H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01541C 100 µg
MO-AB-07549R Monoclonal Cattle (Bos taurus) WB, ELISA MO07549R 100 µg
MO-AB-14235Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14235Y 100 µg
MO-AB-24144H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24144C 100 µg
MO-AB-26781W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26781W 100 µg
MO-AB-34405W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34405W 100 µg
MO-AB-51168W Monoclonal Marmoset WB, ELISA MO51168W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO01174FYA
SpecificityThis antibody binds to fruit fly Arfrp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Arfrp1 Antibody is a mouse antibody against Arfrp1. It can be used for Arfrp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG7039-PA; LD17730p; Arfrp1
UniProt IDQ9W389
Protein RefseqThe length of the protein is 200 amino acids long.
The sequence is show below: MYTLMHGFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIKRHAVVRPPREND.
For Research Use Only | Not For Clinical Use.
Online Inquiry