AibGenesis™ Mouse Anti-Arfrp1 Antibody (CBMOAB-01174FYA)
Cat: CBMOAB-01174FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-01174FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO01174FYA | 100 µg | ||
| CBMOAB-36130FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36130FYA | 100 µg | ||
| CBMOAB-66316FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66316FYA | 100 µg | ||
| MO-AB-01541H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01541C | 100 µg | ||
| MO-AB-07549R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07549R | 100 µg | ||
| MO-AB-14235Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14235Y | 100 µg | ||
| MO-AB-24144H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24144C | 100 µg | ||
| MO-AB-26781W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26781W | 100 µg | ||
| MO-AB-34405W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34405W | 100 µg | ||
| MO-AB-51168W | Monoclonal | Marmoset | WB, ELISA | MO51168W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO01174FYA |
| Specificity | This antibody binds to fruit fly Arfrp1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Golgi apparatus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified. (From NCBI) |
| Product Overview | Mouse Anti-D. melanogaster Arfrp1 Antibody is a mouse antibody against Arfrp1. It can be used for Arfrp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CG7039-PA; LD17730p; Arfrp1 |
| UniProt ID | Q9W389 |
| Protein Refseq | The length of the protein is 200 amino acids long. The sequence is show below: MYTLMHGFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLNIGTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGVIYVIDSNDRERMEESKAIFDKMIKNELLSGVPLLILANKQDLPDVMGVREIKPVFQQAGALIGRRDCLTIPVSALHGEGVDEGIKWLVEAIKRHAVVRPPREND. |
For Research Use Only | Not For Clinical Use.
Online Inquiry