Mouse Anti-ArgF Antibody (MO-AB-00037W)


Cat: MO-AB-00037W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00037W Monoclonal Barrel medic (Medicago truncatula), E. coli (Escherichia coli ), E. coli (Escherichia coli) WB, ELISA MO00037W 100 µg
CBMOAB-0143YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO0143YC 100 µg
MO-DKB-00302W Polyclonal E. coli (Escherichia coli) ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula), E. coli (Escherichia coli ), E. coli (Escherichia coli)
CloneMO00037W
SpecificityThis antibody binds to Barrel medic ArgF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionReversibly catalyzes the transfer of the carbamoyl group from carbamoyl phosphate (CP) to the N(epsilon) atom of ornithine (ORN) to produce L-citrulline, which is a substrate for argininosuccinate synthetase, the enzyme involved in the final step in arginine biosynthesis.
Product OverviewMouse Anti-Barrel medic ArgF Antibody is a mouse antibody against ArgF. It can be used for ArgF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPlastid ornithine carbamoyltransferase; EC 2.1.3.3; ArgF
UniProt IDB9V280
Protein RefseqThe length of the protein is 369 amino acids long.
The sequence is show below: MGVMSGHCCAVVSHKPYLSLSPPNLRHSPPISSVSSSPFPLTTISCHATSALSAESPLTEKVGNGLKDFLHIDDFDKDTIFKILDRAIEVKTLLKSGDRTFRPFEGRTMSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMDKREETRDVARVLSRYNDIILARVFSHQDILDLAKYATVPVINGLTDYNHPCQIMADALTMIEHVGRFEGTKVVYVGDGNNIVHSWLLMAAVIPFHFVCACPKGFEPDAKTVEKARKAGISKIEITNDPKEAVKGADVVYSDVWASMGQKEEAAYRRQVFKEFQVDQSLMDAAGSKAFFMHCLPAERGVEVTEQVVEAPYSIVFPQAENRMHAQNAIMLHVLGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry