AibGenesis™ Mouse Anti-ARHGAP32 Antibody (CBMOAB-36163FYA)


Cat: CBMOAB-36163FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36163FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36163FYA 100 µg
MO-AB-01112W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01112W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO36163FYA
SpecificityThis antibody binds to Rhesus ARHGAP32.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ARHGAP32 Antibody is a mouse antibody against ARHGAP32. It can be used for ARHGAP32 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesARHGAP32
UniProt IDF6ZRM3
Protein RefseqThe length of the protein is 304 amino acids long.
The sequence is show below: QVGLFPGHCVELINQKVPQSVTNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLKQRGILKERVFGCDLGEHLLNSGFEVPQVLQSCTAFIERYGIVDGIYRLSGVASNIQRLRHEFDSEHVPDLTKEPYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAKNLAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFILNHVDVLFMQMPPAVQIIIPFMLLRKQFTPPLLGPMSPLNPLVQKTVCISV.
For Research Use Only | Not For Clinical Use.
Online Inquiry