Mouse Anti-arl8a Antibody (CBMOAB-66542FYA)


Cat: CBMOAB-66542FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-66542FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Sheep (Ovis aries), Marmoset WB, ELISA MO66542FYA 100 µg
MO-AB-14249Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14249Y 100 µg
MO-AB-18739W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18739W 100 µg
MO-AB-24173H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24173C 100 µg
MO-AB-51294W Monoclonal Marmoset WB, ELISA MO51294W 100 µg
MO-DKB-03552W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Sheep (Ovis aries), Marmoset
CloneMO66542FYA
SpecificityThis antibody binds to Zebrafish arl8a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMay play a role in lysosomes motility. Alternatively, may play a role in chromosome segregation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish arl8a Antibody is a mouse antibody against arl8a. It can be used for arl8a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesarl8a; si:ch1073-204j4.2; ADP Ribosylation Factor Like GTPase 8A
UniProt IDE7FF49
Protein RefseqThe length of the protein is 187 amino acids long.
The sequence is show below: MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADPEKIEASKNELHNLLDKPQLQGIPVRVLGNKRDLPGALDEKELIERMNLSAIQDREICCYSISCKEKDNIADITLQWLIQHSRTRRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry