AibGenesis™ Mouse Anti-armt1 Antibody (CBMOAB-60890FYC)


Cat: CBMOAB-60890FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60890FYC Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO60890FYC 100 µg
MO-AB-14401W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14401W 100 µg
MO-AB-51315W Monoclonal Marmoset WB, ELISA MO51315W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset
CloneMO60890FYC
SpecificityThis antibody binds to Zebrafish armt1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMetal-dependent phosphatase that shows phosphatase activity against several substrates, including fructose-1-phosphate and fructose-6-phosphate. Its preference for fructose-1-phosphate, a strong glycating agent that causes DNA damage rather than a canonical yeast metabolite, suggests a damage-control function in hexose phosphate metabolism. Has also been shown to have O-methyltransferase activity that methylates glutamate residues of target proteins to form gamma-glutamyl methyl ester residues. Possibly methylates PCNA, suggesting it is involved in the DNA damage response. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish armt1 Antibody is a mouse antibody against armt1. It can be used for armt1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUPF0364 protein C6orf211 homolog; armt1
UniProt IDQ58EM4
Protein RefseqThe length of the protein is 448 amino acids long.
The sequence is show below: MEAEGMLPPQSLSAKFEGSFAYLTVRDRLPTILTKVVDTLHRNKDNFYKEYGEEGTEAEKRAISFLSRLRNELQTDKPVLALTDNAEDTQAWNEYMERQQDLMENGQLVSWFKSPWLYVECYMYRRIQEALYMNPPMHNFDPFKEGKTQSYFESQQAIKYLCTYLQELITNMENMTEIQLRENFLKLIQVSLWGNKCDLSISAGQDNSQKLSPIDSLPDLQRFILVDDSSMVWSTLVASQGSRSSGMKHARVDIILDNAGFELVTDLVLADFLISSGLAKQIRFHGKSIPWFVSDVTKQDFEWTIKQTMAANHKWMSASGVQWKHFMKEGTWSYHDHPFWTLPHEFCDMTVDAANLYSTLQTSDLILFKGDLNYRKLTGDRKWEHTVRFDQALRGFQPAPLCSLRTLKADVQVGLQAGHAEKLSTQDPDWMTNGKYAVVQFSSPHREQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry