AibGenesis™ Mouse Anti-ASCC1 Antibody (CBMOAB-36373FYA)


Cat: CBMOAB-36373FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36373FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO36373FYA 100 µg
CBMOAB-66738FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66738FYA 100 µg
MO-AB-07684R Monoclonal Cattle (Bos taurus) WB, ELISA MO07684R 100 µg
MO-AB-16990W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16990W 100 µg
MO-AB-36712W Monoclonal Goat (Capra hircus) WB, ELISA MO36712W 100 µg
MO-AB-43735W Monoclonal Horse (Equus caballus) WB, ELISA MO43735W 100 µg
MO-AB-51384W Monoclonal Marmoset WB, ELISA MO51384W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Horse (Equus caballus), Marmoset, Zebrafish (Danio rerio)
CloneMO36373FYA
SpecificityThis antibody binds to Rhesus ASCC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of the activating signal cointegrator 1 (ASC-1) complex. The ASC-1 complex is a transcriptional coactivator that plays an important role in gene transactivation by multiple transcription factors including activating protein 1 (AP-1), nuclear factor kappa-B (NF-kB) and serum response factor (SRF). The encoded protein contains an N-terminal KH-type RNA-binding motif which is required for AP-1 transactivation by the ASC-1 complex. Mutations in this gene are associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ASCC1 Antibody is a mouse antibody against ASCC1. It can be used for ASCC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesASCC1
UniProt IDF7F372
Protein RefseqThe length of the protein is 194 amino acids long.
The sequence is show below: MEVLRPQLIRIDGRNYRKNPVQEQTYQHEEDEEDFYQGSMECADEPCDAYEVEQTPQGFRSTVRAPSLLYNLIHLNTSNDCGFQKITLDCQNIYTWKSRQVMHIVGRRGDTRKKIEMETKTSISIPKPGEDGEIVITGQHRNGVISARTRIDVLLDTFRRKQPFTHFLAFFLNEVEVQEGFLRFQEEVLAKCSM.
For Research Use Only | Not For Clinical Use.
Online Inquiry