Mouse Anti-ASCL2 Antibody (CBMOAB-36376FYA)
Cat: CBMOAB-36376FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36376FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa) | WB, ELISA | MO36376FYA | 100 µg | ||
| MO-AB-01651H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01651C | 100 µg | ||
| MO-AB-07688R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07688R | 100 µg | ||
| MO-AB-23888R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23888R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa) |
| Clone | MO36376FYA |
| Specificity | This antibody binds to Rhesus ASCL2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ASCL2 Antibody is a mouse antibody against ASCL2. It can be used for ASCL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ASCL2 |
| UniProt ID | F7BGV6 |
| Protein Refseq | The length of the protein is 193 amino acids long. The sequence is show below: MDGGALPRSAPPAPRVPVSCAARRRPTSPELLRCSRRRRPATAETGDSAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPPAVRPSAPRGQPGTTAVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry