Mouse Anti-ASCL2 Antibody (CBMOAB-36376FYA)


Cat: CBMOAB-36376FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36376FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa) WB, ELISA MO36376FYA 100 µg
MO-AB-01651H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01651C 100 µg
MO-AB-07688R Monoclonal Cattle (Bos taurus) WB, ELISA MO07688R 100 µg
MO-AB-23888R Monoclonal Pig (Sus scrofa) WB, ELISA MO23888R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa)
CloneMO36376FYA
SpecificityThis antibody binds to Rhesus ASCL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. (From NCBI)
Product OverviewMouse Anti-Rhesus ASCL2 Antibody is a mouse antibody against ASCL2. It can be used for ASCL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesASCL2
UniProt IDF7BGV6
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: MDGGALPRSAPPAPRVPVSCAARRRPTSPELLRCSRRRRPATAETGDSAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPPAVRPSAPRGQPGTTAVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY.
For Research Use Only | Not For Clinical Use.
Online Inquiry