Mouse Anti-ASIP Antibody (MO-AB-22968H)
Cat: MO-AB-22968H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-22968H | Monoclonal | Mallard (Anas platyrhynchos), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Goat (Capra hircus), Gorilla, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO22968C | 100 µg | ||
MO-AB-08795W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08795W | 100 µg | ||
MO-AB-29057W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29057W | 100 µg | ||
MO-AB-36713W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36713W | 100 µg | ||
MO-AB-38445W | Monoclonal | Gorilla | WB, ELISA | MO38445W | 100 µg | ||
MO-AB-07695R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07695R | 100 µg | ||
MO-AB-23892R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23892R | 100 µg | ||
MO-AB-24205H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24205C | 100 µg | ||
MO-AB-00192Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO00192Y | 100 µg | ||
MO-AB-07268Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07268Y | 100 µg | ||
MO-AB-10678Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10678Y | 100 µg | ||
MO-AB-14265Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14265Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Mallard (Anas platyrhynchos), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Goat (Capra hircus), Gorilla, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO22968C |
Specificity | This antibody binds to Mallard ASIP. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes. (From NCBI) |
Product Overview | This product is a mouse antibody against ASIP. It can be used for ASIP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Agouti signaling protein; ASIP |
UniProt ID | S4S2Z6 |
Protein Refseq | The length of the protein is 130 amino acids long. The sequence is show below: MEKKNLFLSLLLCYNLLRATNSHMVIEEKTERNLSRNSKMNLSDLPPISIVDLTKRSQRVSRKEAENKKSSKKKAELKKPPKPRPTPAADCVPNFKTCKPHLNSCCNYCALCKCRIFQTICQCLTLNPKC. |
See other products for " ASIP "
MO-AB-43738W | Mouse Anti-ASIP Antibody (MO-AB-43738W) |
CBMOAB-63803FYA | Mouse Anti-asip Antibody (CBMOAB-63803FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry