Mouse Anti-ASPA Antibody (MO-AB-07707R)


Cat: MO-AB-07707R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07707R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO07707R 100 µg
CBMOAB-66790FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66790FYA 100 µg
MO-AB-25652W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25652W 100 µg
MO-AB-51409W Monoclonal Marmoset WB, ELISA MO51409W 100 µg
MO-DKB-01129W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO07707R
SpecificityThis antibody binds to Cattle ASPA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that catalyzes the conversion of N-acetyl_L-aspartic acid (NAA) to aspartate and acetate. NAA is abundant in the brain where hydrolysis by aspartoacylase is thought to help maintain white matter. This protein is an NAA scavenger in other tissues. Mutations in this gene cause Canavan disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle ASPA Antibody is a mouse antibody against ASPA. It can be used for ASPA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAspartoacylase; EC 3.5.1.15; Aminoacylase-2; ACY-2; ASPA; ACY2
UniProt IDP46446
Protein RefseqThe length of the protein is 313 amino acids long.
The sequence is show below: MTSCHVAEDPIKKVAIFGGTHGNELTGVFLVKHWLENSTEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRVFDPENLGKKKSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNDFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIQHALDFIHNFNEGKEFPPCAIEVYKIMRKVDYPRNESGEISAIIHPKLQDQDWKPL.
See other products for " aspA "
For Research Use Only | Not For Clinical Use.
Online Inquiry