AibGenesis™ Mouse Anti-ATF6B Antibody (CBMOAB-36476FYA)


Cat: CBMOAB-36476FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36476FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Medaka (Oryzias latipes), Zebrafish (Danio rerio) WB, ELISA MO36476FYA 100 µg
CBMOAB-66879FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66879FYA 100 µg
MO-AB-00097R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00097R 100 µg
MO-AB-01188W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01188W 100 µg
MO-AB-07742R Monoclonal Cattle (Bos taurus) WB, ELISA MO07742R 100 µg
MO-AB-18820W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18820W 100 µg
MO-AB-51448W Monoclonal Marmoset WB, ELISA MO51448W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Medaka (Oryzias latipes), Zebrafish (Danio rerio)
CloneMO36476FYA
SpecificityThis antibody binds to Rhesus ATF6B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ATF6B Antibody is a mouse antibody against ATF6B. It can be used for ATF6B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATF6B
UniProt IDF7AHU8
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: MAELMLLSEIADPTRFFADNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDPSPTDQPSFRNLTTFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSLPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPN.
For Research Use Only | Not For Clinical Use.
Online Inquiry