Mouse Anti-ATG3 Antibody (CBMOAB-24516FYC)


Cat: CBMOAB-24516FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
  • Relate Reference Data
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-24516FYC Monoclonal A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Maize (Zea mays), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Yeast, Zebrafish (Danio rerio) WB, ELISA MO24516FC 100 µg
CBMOAB-02004FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02004FYA 100 µg
CBMOAB-66915FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66915FYA 100 µg
CBMOAB-00385CR Monoclonal Yeast WB, ELISA MO00385CR 100 µg
CBMOAB-00748HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO00748HB 100 µg
MO-AB-08930W Monoclonal Cat (Felis catus) WB, ELISA MO08930W 100 µg
MO-AB-22212W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22212W 100 µg
MO-AB-29071W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29071W 100 µg
MO-AB-41275W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41275W 100 µg
MO-AB-43754W Monoclonal Horse (Equus caballus) WB, ELISA MO43754W 100 µg
MO-AB-47416W Monoclonal Maize (Zea mays) WB, ELISA MO47416W 100 µg
MO-AB-51467W Monoclonal Marmoset WB, ELISA MO51467W 100 µg
MO-AB-07750R Monoclonal Cattle (Bos taurus) WB, ELISA MO07750R 100 µg
MO-AB-00099R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00099R 100 µg
MO-AB-23912R Monoclonal Pig (Sus scrofa) WB, ELISA MO23912R 100 µg
MO-AB-00120L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00120L 100 µg
MO-AB-00206Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00206Y 100 µg
MO-AB-07277Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07277Y 100 µg
MO-AB-14279Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14279Y 100 µg
MO-DKB-0058RA Polyclonal A. thaliana (Arabidopsis thaliana) WB 50 µL

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Guinea pig (Cavia porcellus), Horse (Equus caballus), Maize (Zea mays), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Yeast, Zebrafish (Danio rerio)
CloneMO24516FC
SpecificityThis antibody binds to Arabidopsis ATG3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Arabidopsis ATG3 Antibody is a mouse antibody against ATG3. It can be used for ATG3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAutophagy Related 3; Autophagy-Related Protein 3; APG3-LIKE; APG3L; HApg3; APG3; ATG3 Autophagy Related 3 Homolog (S. Cerevisiae); Ubiquitin-Like-Conjugating Enzyme ATG3
UniProt IDQ0WWQ1
Protein RefseqThe length of the protein is 313 amino acids long. The sequence is show below: MVLSQKLHEAFKGTVERITGPRTISAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGDASKRKPYLPSDKQFLITRNVPCLRRAASVAEDYEAAGGEVLVDDEDNDGWLATHGKPKDKGKEEDNLPSMDALDINEKNTIQSIPTYFGGEEDDDIPDMEEFDEADNVVENDPATLQSTYLVAHEPDDDNILRTRTYDLSITYDKYYQTPRVWLTGYDESRMLLQPELVMEDVSQDHARKTVTIEDHPHLPGKHASVHPCRHGAVMKKIIDVLMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSST.

Reference

Reference1. Wang, P., Sun, X., Wang, N., Jia, X., & Ma, F. (2017). Ectopic expression of an autophagy-associated MdATG7b gene from apple alters growth and tolerance to nutrient stress in Arabidopsis thaliana. Plant Cell, Tissue and Organ Culture (PCTOC), 128, 9-23.
2. Guan, B., & Xue, H. W. (2022). Arabidopsis AUTOPHAGY-RELATED3 (ATG3) facilitates the liquid-liquid phase separation of ATG8e to promote autophagy. Science Bulletin, 67(4), 350-354.
See other products for " atg3 "

Relate Reference Data

Figure 1 Expression levels of Arabidopsis ATG genes. Microarray expression levels of the nine-member ATG8 gene family (A) and other ATG genes (B) in various Arabidopsis tissues. Expression levels are graphed as normalized expression units × 102.
Reference: Thompson, A. R., Doelling, J. H., Suttangkakul, A., & Vierstra, R. D. (2005). Autophagic nutrient recycling in Arabidopsis directed by the ATG8 and ATG12 conjugation pathways. Plant physiology, 138(4), 2097-2110.

For Research Use Only | Not For Clinical Use.
Online Inquiry