Mouse Anti-ATG9B Antibody (CBMOAB-36508FYA)


Cat: CBMOAB-36508FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36508FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO36508FYA 100 µg
CBMOAB-66935FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66935FYA 100 µg
MO-AB-23920R Monoclonal Pig (Sus scrofa) WB, ELISA MO23920R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO36508FYA
SpecificityThis antibody binds to Rhesus ATG9B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene functions in the regulation of autophagy, a lysosomal degradation pathway. This gene also functions as an antisense transcript in the posttranscriptional regulation of the endothelial nitric oxide synthase 3 gene, which has 3' overlap with this gene on the opposite strand. Mutations in this gene and disruption of the autophagy process have been associated with multiple cancers. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus ATG9B Antibody is a mouse antibody against ATG9B. It can be used for ATG9B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATG9B
UniProt IDF7GX70
Protein RefseqThe length of the protein is 409 amino acids long.
The sequence is show below: MPSYPQPSVLRGSAPARCSSSSWSWLRASGWSNCFAQSATSSATGTSRCFTGRPCTSPRSFIPEEQCQGRAPQLLLQTALAHMHYLPEEPGPGGRDRAYRQMAQLLQYRAVSLLEELLSPLLTPLFLLFWFRPRALEIIDFFHHFTVDVAGVGDICSFALMDVKRHGHPQWLSAGQTEASLSQRAEDGKTELSLMRFSLAHPLWRPPGHSSKFLGHLWGRVQQDAAAWGATSARSPPTPGVLSNCTSPLPEAFLANLFMHPLLPPRDLSPTAPCPAAATASLLASISRIAQDPSSVSPGGTGGQKLAQLPELASAEMSLHAIYLHQLHQQQQQEPWGEAAASVLSRPYSSPSQPPSPDEEKPSWSSDGSSPASSPRQQWGTQRARNLFPGGFQVTTDTQKEPDEASCTD.
See other products for " ATG9B "
For Research Use Only | Not For Clinical Use.
Online Inquiry