Mouse Anti-Atox1 Antibody (CBMOAB-02025FYA)


Cat: CBMOAB-02025FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02025FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO02025FYA 100 µg
CBMOAB-66972FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66972FYA 100 µg
MO-AB-07768R Monoclonal Cattle (Bos taurus) WB, ELISA MO07768R 100 µg
MO-AB-10686Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10686Y 100 µg
MO-AB-14285Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14285Y 100 µg
MO-AB-21556W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21556W 100 µg
MO-AB-23929R Monoclonal Pig (Sus scrofa) WB, ELISA MO23929R 100 µg
MO-AB-24222H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24222C 100 µg
MO-AB-29076W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29076W 100 µg
MO-AB-51497W Monoclonal Marmoset WB, ELISA MO51497W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO02025FYA
SpecificityThis antibody binds to fruit fly Atox1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Atox1 Antibody is a mouse antibody against Atox1. It can be used for Atox1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAtox1, isoform B; Atox1
UniProt IDM9PD88
Protein RefseqThe length of the protein is 89 amino acids long.
The sequence is show below: MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVGVKKXDEFLSKFQKYGRLKLEV.
For Research Use Only | Not For Clinical Use.
Online Inquiry