Mouse Anti-Atox1 Antibody (CBMOAB-02025FYA)
Cat: CBMOAB-02025FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02025FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO02025FYA | 100 µg | ||
| CBMOAB-66972FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66972FYA | 100 µg | ||
| MO-AB-07768R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07768R | 100 µg | ||
| MO-AB-10686Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10686Y | 100 µg | ||
| MO-AB-14285Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14285Y | 100 µg | ||
| MO-AB-21556W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21556W | 100 µg | ||
| MO-AB-23929R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23929R | 100 µg | ||
| MO-AB-24222H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24222C | 100 µg | ||
| MO-AB-29076W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29076W | 100 µg | ||
| MO-AB-51497W | Monoclonal | Marmoset | WB, ELISA | MO51497W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO02025FYA |
| Specificity | This antibody binds to fruit fly Atox1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. |
| Product Overview | Mouse Anti-D. melanogaster Atox1 Antibody is a mouse antibody against Atox1. It can be used for Atox1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Atox1, isoform B; Atox1 |
| UniProt ID | M9PD88 |
| Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVGVKKXDEFLSKFQKYGRLKLEV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry