Mouse Anti-ATP1B3 Antibody (CBMOAB-36554FYA)
Cat: CBMOAB-36554FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36554FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO36554FYA | 100 µg | ||
| MO-AB-01706H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01706C | 100 µg | ||
| MO-AB-07289Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07289Y | 100 µg | ||
| MO-AB-07779R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07779R | 100 µg | ||
| MO-AB-25414W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25414W | 100 µg | ||
| MO-AB-41284W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41284W | 100 µg | ||
| MO-AB-43760W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43760W | 100 µg | ||
| MO-AB-51513W | Monoclonal | Marmoset | WB, ELISA | MO51513W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Rabbit (Oryctolagus cuniculus) |
| Clone | MO36554FYA |
| Specificity | This antibody binds to Rhesus ATP1B3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. |
| Product Overview | Mouse Anti-Rhesus ATP1B3 Antibody is a mouse antibody against ATP1B3. It can be used for ATP1B3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ATP1B3 |
| UniProt ID | F6V064 |
| Protein Refseq | The length of the protein is 265 amino acids long. The sequence is show below: MLSEGDILFSSLLSSPSLFWPPGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVLKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVTFKITARA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry