Mouse Anti-ATP5G2 Antibody (CBMOAB-36570FYA)


Cat: CBMOAB-36570FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36570FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa) WB, ELISA MO36570FYA 100 µg
MO-AB-01203W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01203W 100 µg
MO-AB-21360W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21360W 100 µg
MO-AB-23961R Monoclonal Pig (Sus scrofa) WB, ELISA MO23961R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Pig (Sus scrofa)
CloneMO36570FYA
SpecificityThis antibody binds to Rhesus ATP5G2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ATP5G2 Antibody is a mouse antibody against ATP5G2. It can be used for ATP5G2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP5G2
UniProt IDF7H2N0
Protein RefseqThe length of the protein is 198 amino acids long.
The sequence is show below: MPELILYVAITLSVVERLVGPGHACAEPSFRYSRCSAPLRLLCSGRSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDEGLSSLAVSRPLTSLVSSRSFQTSATSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM.
For Research Use Only | Not For Clinical Use.
Online Inquiry