Mouse Anti-atp5j Antibody (CBMOAB-67106FYA)


Cat: CBMOAB-67106FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-67106FYA Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO67106FYA 100 µg
MO-AB-08575W Monoclonal Cat (Felis catus) WB, ELISA MO08575W 100 µg
MO-AB-10692Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10692Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), O. mykiss (Oncorhynchus mykiss)
CloneMO67106FYA
SpecificityThis antibody binds to Zebrafish atp5j.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMitochondrial membrane ATP synthase (FF ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish atp5j Antibody is a mouse antibody against atp5j. It can be used for atp5j detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase-coupling factor 6, mitochondrial; ATPase subunit F6; atp5
UniProt IDQ6NYF7
Protein RefseqThe length of the protein is 112 amino acids long.
The sequence is show below: MALHSGFARVSSLLRSALSVSLRRNIGLSAVLFNKAKDMDPIQKLFLDKIRDYNSKSKASGGVVDAGPVYQKNLAEETTKLQRLYGGGDLSKFPQFSFTGLTCVMRIVTADD.
For Research Use Only | Not For Clinical Use.
Online Inquiry