AibGenesis™ Mouse Anti-ATP5J2 Antibody (CBMOAB-36573FYA)


Cat: CBMOAB-36573FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36573FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO36573FYA 100 µg
MO-AB-13913W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13913W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO36573FYA
SpecificityThis antibody binds to Rhesus ATP5J2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ATP5J2 Antibody is a mouse antibody against ATP5J2. It can be used for ATP5J2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase subunit f, mitochondrial isoform 2b; ATP5J2
UniProt IDI0FLU6
Protein RefseqThe length of the protein is 88 amino acids long.
The sequence is show below: MASVVPVKDKKLLEVKLGELPSWILMRDFSPSGILGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFNYCISYKHLNHKQLRKYH.
For Research Use Only | Not For Clinical Use.
Online Inquiry