Mouse Anti-ATP5ME Antibody (MO-AB-07806R)


Cat: MO-AB-07806R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07806R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO07806R 100 µg
MO-AB-24237H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24237C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO07806R
SpecificityThis antibody binds to Cattle ATP5ME.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ATP5ME Antibody is a mouse antibody against ATP5ME. It can be used for ATP5ME detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase subunit e, mitochondrial; ATPase subunit e; ATP5I
UniProt IDQ00361
Protein RefseqThe length of the protein is 71 amino acids long.
The sequence is show below: MVPPVQVSPLIKLGRYSALFLGMAYGAKRYNYLKPRAEEERRLAAEEKKKRDEQKRIERELAEAQEDTILK.
For Research Use Only | Not For Clinical Use.
Online Inquiry