Mouse Anti-ATP6V0B Antibody (CBMOAB-36593FYA)


Cat: CBMOAB-36593FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36593FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO36593FYA 100 µg
CBMOAB-67128FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67128FYA 100 µg
MO-AB-01738H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01738C 100 µg
MO-AB-07840R Monoclonal Cattle (Bos taurus) WB, ELISA MO07840R 100 µg
MO-AB-24248H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24248C 100 µg
MO-AB-25356W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25356W 100 µg
MO-AB-51585W Monoclonal Marmoset WB, ELISA MO51585W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO36593FYA
SpecificityThis antibody binds to Rhesus ATP6V0B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a portion of the V0 domain of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Activity of this enzyme is necessary for such varied processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ATP6V0B Antibody is a mouse antibody against ATP6V0B. It can be used for ATP6V0B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP6V0B
UniProt IDF7FYA5
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MTGLALLYSGVFVAFWACALAVGICYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQVMNPLGEPLCPCPQPSLTLLLEKLKCSPSLPITVDSPKQLPPPRFHLLVFSCRGYFCL.
For Research Use Only | Not For Clinical Use.
Online Inquiry