Mouse Anti-ATP6V1E1 Antibody (MO-AB-07856R)
Cat: MO-AB-07856R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-07856R | Monoclonal | Cattle (Bos taurus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO07856R | 100 µg | ||
MO-AB-24256H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24256C | 100 µg | ||
MO-AB-14317Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14317Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO07856R |
Specificity | This antibody binds to Cattle ATP6V1E1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Endosome; Plasma membrane; Cytosol; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. |
Product Overview | Mouse Anti-Cattle ATP6V1E1 Antibody is a mouse antibody against ATP6V1E1. It can be used for ATP6V1E1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | V-type proton ATPase subunit E 1; V-ATPase subunit E 1; V-ATPase 31 kDa subunit; P31; Vacuolar proton pump subunit E 1; ATP6V1E1; ATP6E |
UniProt ID | P11019 |
Protein Refseq | The length of the protein is 226 amino acids long. The sequence is show below: MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPVYKVATKRDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD. |
See other products for " ATP6V1E1 "
MO-AB-12699W | Mouse Anti-ATP6V1E1 Antibody (MO-AB-12699W) |
CBMOAB-36600FYA | Mouse Anti-ATP6V1E1 Antibody (CBMOAB-36600FYA) |
MO-AB-43811W | Mouse Anti-ATP6V1E1 Antibody (MO-AB-43811W) |
MO-AB-51599W | Mouse Anti-ATP6V1E1 Antibody (MO-AB-51599W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry