AibGenesis™ Mouse Anti-ATP9B Antibody (CBMOAB-36618FYA)


Cat: CBMOAB-36618FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36618FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO36618FYA 100 µg
CBMOAB-67190FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67190FYA 100 µg
MO-AB-07881R Monoclonal Cattle (Bos taurus) WB, ELISA MO07881R 100 µg
MO-AB-11473W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11473W 100 µg
MO-AB-51615W Monoclonal Marmoset WB, ELISA MO51615W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO36618FYA
SpecificityThis antibody binds to Rhesus ATP9B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ATP9B Antibody is a mouse antibody against ATP9B. It can be used for ATP9B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP9B
UniProt IDF7ET85
Protein RefseqThe length of the protein is 143 amino acids long.
The sequence is show below: MHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKKQANGRSNRRELEPLTSGTSGHVWGPGSFFRIRVPGKGTNAGKILVLQNLPHLGFNQHLPRWHPHVRGPSALRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry