Mouse Anti-Atpase6 Antibody (CBMOAB-02039FYA)
Cat: CBMOAB-02039FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-02039FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cat (Felis catus), Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Sheep (Ovis aries), Silkworm (Bombyx mori) | WB, ELISA | MO02039FYA | 100 µg | ||
| MO-AB-00122R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00122R | 100 µg | ||
| MO-AB-08788W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08788W | 100 µg | ||
| MO-AB-10697Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10697Y | 100 µg | ||
| MO-AB-14324Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14324Y | 100 µg | ||
| MO-AB-24270H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24270C | 100 µg | ||
| MO-AB-68843W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO68843W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cat (Felis catus), Medaka (Oryzias latipes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Sheep (Ovis aries), Silkworm (Bombyx mori) |
| Clone | MO02039FYA |
| Specificity | This antibody binds to fruit fly Atpase6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-D. melanogaster Atpase6 Antibody is a mouse antibody against Atpase6. It can be used for Atpase6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ATP synthase F0 subunit 6; Fragment; ATPase6 |
| UniProt ID | B1PTQ1 |
| Protein Refseq | The length of the protein is 57 amino acids long. The sequence is show below: GHLLLTLLGKTGSSMSYMLMTFLLMAQIALLVLESAVAMIQSYVFAVLSTLYSSEVN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry