Mouse Anti-AVIL Antibody (CBMOAB-36662FYA)


Cat: CBMOAB-36662FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36662FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO36662FYA 100 µg
CBMOAB-67247FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67247FYA 100 µg
MO-AB-03414W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03414W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO36662FYA
SpecificityThis antibody binds to Rhesus AVIL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia.
Product OverviewMouse Anti-Rhesus AVIL Antibody is a mouse antibody against AVIL. It can be used for AVIL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdvillin; AVIL
UniProt IDH9FEE6
Protein RefseqThe length of the protein is 69 amino acids long.
The sequence is show below: LSVNSIDSESKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry