Mouse Anti-AVIL Antibody (CBMOAB-36662FYA)
Cat: CBMOAB-36662FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-36662FYA | Monoclonal | Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO36662FYA | 100 µg | ||
CBMOAB-67247FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67247FYA | 100 µg | ||
MO-AB-03414W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO03414W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO36662FYA |
Specificity | This antibody binds to Rhesus AVIL. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia. (From NCBI) |
Product Overview | Mouse Anti-Rhesus AVIL Antibody is a mouse antibody against AVIL. It can be used for AVIL detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Advillin; AVIL |
UniProt ID | H9FEE6 |
Protein Refseq | The length of the protein is 69 amino acids long. The sequence is show below: LSVNSIDSESKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry