Mouse Anti-BAALC Antibody (CBMOAB-36725FYA)


Cat: CBMOAB-36725FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36725FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO36725FYA 100 µg
MO-AB-01238W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO01238W 100 µg
MO-AB-07944R Monoclonal Cattle (Bos taurus) WB, ELISA MO07944R 100 µg
MO-AB-17473W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17473W 100 µg
MO-AB-24059R Monoclonal Pig (Sus scrofa) WB, ELISA MO24059R 100 µg
MO-AB-24312H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24312C 100 µg
MO-AB-51704W Monoclonal Marmoset WB, ELISA MO51704W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO36725FYA
SpecificityThis antibody binds to Rhesus BAALC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene was identified by gene expression studies in patients with acute myeloid leukemia (AML). The gene is conserved among mammals and is not found in lower organisms. Tissues that express this gene develop from the neuroectoderm. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene; however, some of the transcript variants are found only in AML cell lines.
Product OverviewMouse Anti-Rhesus BAALC Antibody is a mouse antibody against BAALC. It can be used for BAALC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBAALC
UniProt IDF6SVN3
Protein RefseqThe length of the protein is 80 amino acids long.
The sequence is show below: MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDSPPSAAAPDSGPEAGGLHAAHYPLAFALAWRDNSLGALLVQEGLCR.
For Research Use Only | Not For Clinical Use.
Online Inquiry