AibGenesis™ Mouse Anti-BAALC Antibody (CBMOAB-36725FYA)
Cat: CBMOAB-36725FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36725FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO36725FYA | 100 µg | ||
| MO-AB-01238W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01238W | 100 µg | ||
| MO-AB-07944R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07944R | 100 µg | ||
| MO-AB-17473W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17473W | 100 µg | ||
| MO-AB-24059R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24059R | 100 µg | ||
| MO-AB-24312H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24312C | 100 µg | ||
| MO-AB-51704W | Monoclonal | Marmoset | WB, ELISA | MO51704W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO36725FYA |
| Specificity | This antibody binds to Rhesus BAALC. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus BAALC Antibody is a mouse antibody against BAALC. It can be used for BAALC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | BAALC |
| UniProt ID | F6SVN3 |
| Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDSPPSAAAPDSGPEAGGLHAAHYPLAFALAWRDNSLGALLVQEGLCR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry