Mouse Anti-BAALC Antibody (CBMOAB-36725FYA)
Cat: CBMOAB-36725FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-36725FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO36725FYA | 100 µg | ||
MO-AB-01238W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO01238W | 100 µg | ||
MO-AB-07944R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07944R | 100 µg | ||
MO-AB-17473W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17473W | 100 µg | ||
MO-AB-24059R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24059R | 100 µg | ||
MO-AB-24312H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24312C | 100 µg | ||
MO-AB-51704W | Monoclonal | Marmoset | WB, ELISA | MO51704W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) |
Clone | MO36725FYA |
Specificity | This antibody binds to Rhesus BAALC. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene was identified by gene expression studies in patients with acute myeloid leukemia (AML). The gene is conserved among mammals and is not found in lower organisms. Tissues that express this gene develop from the neuroectoderm. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene; however, some of the transcript variants are found only in AML cell lines. |
Product Overview | Mouse Anti-Rhesus BAALC Antibody is a mouse antibody against BAALC. It can be used for BAALC detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | BAALC |
UniProt ID | F6SVN3 |
Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDSPPSAAAPDSGPEAGGLHAAHYPLAFALAWRDNSLGALLVQEGLCR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry