Mouse Anti-BAG4 Antibody (MO-AB-07952R)


Cat: MO-AB-07952R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07952R Monoclonal Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO07952R 100 µg
CBMOAB-67382FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67382FYA 100 µg
MO-AB-51718W Monoclonal Marmoset WB, ELISA MO51718W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO07952R
SpecificityThis antibody binds to Cattle BAG4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. Alternatively spliced transcript variants encoding distinct isoforms have been identified. (From NCBI)
Product OverviewMouse Anti-Cattle BAG4 Antibody is a mouse antibody against BAG4. It can be used for BAG4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBCL2-associated athanogene 4, Fragment; BAG4
UniProt IDQ1JPF8
Protein RefseqThe length of the protein is 447 amino acids long.
The sequence is show below: ALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPIYPPRPEPPQPPISWRGRGGGPAETTWPGEGGGGDGYYASGGAWSEPGRAGGGHQEQPPYPSYNSNYWNSAARPRAPYPSTYPVRPEMQSQSLNSYTNGGYGPPYPTGPGTNTASYPGAYYTPGYAQTNYSTEVPSTYRSPGNSPTPVSRWMYPQQDCQTEAPPLRGQVPGYPASQNPGMSVPHYPYGDGNRSVPQPGPPVRPQEDSWAPPGAYGMGTRYPW.
For Research Use Only | Not For Clinical Use.
Online Inquiry