Mouse Anti-BAG4 Antibody (MO-AB-07952R)
Cat: MO-AB-07952R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-07952R | Monoclonal | Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) | WB, ELISA | MO07952R | 100 µg | ||
| CBMOAB-67382FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO67382FYA | 100 µg | ||
| MO-AB-51718W | Monoclonal | Marmoset | WB, ELISA | MO51718W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) |
| Clone | MO07952R |
| Specificity | This antibody binds to Cattle BAG4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. This protein was found to be associated with the death domain of tumor necrosis factor receptor type 1 (TNF-R1) and death receptor-3 (DR3), and thereby negatively regulates downstream cell death signaling. The regulatory role of this protein in cell death was demonstrated in epithelial cells which undergo apoptosis while integrin mediated matrix contacts are lost. Alternatively spliced transcript variants encoding distinct isoforms have been identified. (From NCBI) |
| Product Overview | Mouse Anti-Cattle BAG4 Antibody is a mouse antibody against BAG4. It can be used for BAG4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | BCL2-associated athanogene 4, Fragment; BAG4 |
| UniProt ID | Q1JPF8 |
| Protein Refseq | The length of the protein is 447 amino acids long. The sequence is show below: ALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPIYPPRPEPPQPPISWRGRGGGPAETTWPGEGGGGDGYYASGGAWSEPGRAGGGHQEQPPYPSYNSNYWNSAARPRAPYPSTYPVRPEMQSQSLNSYTNGGYGPPYPTGPGTNTASYPGAYYTPGYAQTNYSTEVPSTYRSPGNSPTPVSRWMYPQQDCQTEAPPLRGQVPGYPASQNPGMSVPHYPYGDGNRSVPQPGPPVRPQEDSWAPPGAYGMGTRYPW. |
See other products for " BAG4 "
| CBMOAB-36743FYA | Mouse Anti-BAG4 Antibody (CBMOAB-36743FYA) |
| MO-AB-23205W | Mouse Anti-BAG4 Antibody (MO-AB-23205W) |
| CBMOAB-25040FYC | Mouse Anti-BAG4 Antibody (CBMOAB-25040FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry