Mouse Anti-BAK1 Antibody (MO-AB-07959R)
Cat: MO-AB-07959R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-07959R | Monoclonal | WB, ELISA | MO07959R | 100 µg | |||
| CBMOAB-36762FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36762FYA | 100 µg | ||
| MO-AB-08072W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08072W | 100 µg | ||
| MO-AB-13609W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13609W | 100 µg | ||
| MO-AB-51733W | Monoclonal | Marmoset | WB, ELISA | MO51733W | 100 µg | ||
| MO-AB-24067R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24067R | 100 µg | ||
| MO-AB-00297H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00297C | 100 µg | ||
| MO-AB-01798H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01798C | 100 µg | ||
| MO-AB-24317H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24317C | 100 µg | ||
| MO-DKB-0081RA | Polyclonal | WB | 50 µg | ||||
| MO-DKB-02154W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
| MOFAB-202W | Polyclonal | Arabidopsis | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); S. lycopersicum (Solanum lycopersicum), Arabidopsis, Arabidopsis (Arabidopsis lyrata), Cat (Felis catus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
| Clone | MO07959R |
| Specificity | This antibody binds to Cattle BAK1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Mitochondrion; Cytosol; Endoplasmic reticulum |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. |
| Product Overview | Mouse Anti-Cattle BAK1 Antibody is a mouse antibody against BAK1. It can be used for BAK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | BCL2-antagonist/killer 1; Bcl-2 homologous antagonist/killer transcript variant 1; BAK1 |
| UniProt ID | Q05KI7 |
| Protein Refseq | The length of the protein is 211 amino acids long. The sequence is show below: MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEMVTLHPEPSSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVAALDLGNGPIKSVAIVLAVVLLGQFVVRRFFKS. |
See other products for " BAK1 "
| CBMOAB-25046FYC | Mouse Anti-BAK1 Antibody (CBMOAB-25046FYC) |
| MO-MMB-0247 | Rabbit Anti-BAK1 Antibody (Cat MO-MMB-0247) |
For Research Use Only | Not For Clinical Use.
Online Inquiry