Mouse Anti-BAK1 Antibody (MO-AB-07959R)


Cat: MO-AB-07959R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07959R Monoclonal WB, ELISA MO07959R 100 µg
CBMOAB-36762FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36762FYA 100 µg
MO-AB-08072W Monoclonal Cat (Felis catus) WB, ELISA MO08072W 100 µg
MO-AB-13609W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13609W 100 µg
MO-AB-51733W Monoclonal Marmoset WB, ELISA MO51733W 100 µg
MO-AB-24067R Monoclonal Pig (Sus scrofa) WB, ELISA MO24067R 100 µg
MO-AB-00297H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00297C 100 µg
MO-AB-01798H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01798C 100 µg
MO-AB-24317H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24317C 100 µg
MO-DKB-0081RA Polyclonal WB 50 µg
MO-DKB-02154W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
MOFAB-202W Polyclonal Arabidopsis WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), A. thaliana (Arabidopsis thaliana), A. thaliana (Arabidopsis thaliana); S. lycopersicum (Solanum lycopersicum), Arabidopsis, Arabidopsis (Arabidopsis lyrata), Cat (Felis catus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO07959R
SpecificityThis antibody binds to Cattle BAK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion; Cytosol; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. (From NCBI)
Product OverviewMouse Anti-Cattle BAK1 Antibody is a mouse antibody against BAK1. It can be used for BAK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBCL2-antagonist/killer 1; Bcl-2 homologous antagonist/killer transcript variant 1; BAK1
UniProt IDQ05KI7
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEMVTLHPEPSSTMGQVGRQLAVIGDDINRRYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSIARWIAQRGGWVAALDLGNGPIKSVAIVLAVVLLGQFVVRRFFKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry